DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and Kcna6

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_038596.1 Gene:Kcna6 / 16494 MGIID:96663 Length:529 Species:Mus musculus


Alignment Length:103 Identity:20/103 - (19%)
Similarity:31/103 - (30%) Gaps:29/103 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTTSFGKRHNKT------HTICRRCG---------------NSSYHLQKSKCSQ-------C 37
            :|..|..:|..:..|      .::|...|               |..||.:..:..|       |
Mouse   418 VTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTC 482

  Fly    38 GYPAAKTRSF-NWSRKAKGRKAQGTGRMRYLKNLRRRF 74
            |.|....::. |...|....:|....|..||....|.:
Mouse   483 GQPTPDLKATDNGLGKPDFAEASRERRPSYLPTPHRAY 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 20/103 (19%)
Kcna6NP_038596.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
BTB_POZ_KCNA6 41..170 CDD:349714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..238
Ion_trans 259..468 CDD:459842 9/49 (18%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 360..373
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 422..427 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..513 4/24 (17%)
PDZ-binding. /evidence=ECO:0000255 527..529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.