| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_067250.2 | Gene: | Kcna4 / 16492 | MGIID: | 96661 | Length: | 654 | Species: | Mus musculus |
| Alignment Length: | 38 | Identity: | 12/38 - (31%) |
|---|---|---|---|
| Similarity: | 15/38 - (39%) | Gaps: | 11/38 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 RSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGG 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 12/38 (32%) |
| Kcna4 | NP_067250.2 | K_channel_TID | 1..>37 | CDD:429748 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 24..145 | ||||
| BTB_POZ | 177..304 | CDD:453885 | |||
| Ion_trans | 307..571 | CDD:459842 | 12/38 (32%) | ||
| S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 | 463..476 | 5/23 (22%) | |||
| Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 | 525..530 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 630..654 | ||||
| PDZ-binding. /evidence=ECO:0000250|UniProtKB:P15385 | 652..654 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||