DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and Kcna3

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_032444.2 Gene:Kcna3 / 16491 MGIID:96660 Length:528 Species:Mus musculus


Alignment Length:39 Identity:11/39 - (28%)
Similarity:15/39 - (38%) Gaps:12/39 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RMRYLKNLRRRF---RNG---------LREGGAAKKKTN 89
            ||||...||..:   ||.         .:.||..::..|
Mouse    89 RMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVN 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 10/37 (27%)
Kcna3NP_032444.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
BTB 59..153 CDD:197585 11/39 (28%)
BTB_2 59..150 CDD:280393 11/39 (28%)
Ion_trans 243..443 CDD:278921
Ion_trans_2 357..434 CDD:285168
Selectivity filter. /evidence=ECO:0000250 397..402
PDZ-binding. /evidence=ECO:0000250 526..528
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.