DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and Shal

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:XP_061502009.1 Gene:Shal / 1270054 VectorBaseID:AGAMI1_007411 Length:579 Species:Anopheles gambiae


Alignment Length:44 Identity:13/44 - (29%)
Similarity:23/44 - (52%) Gaps:4/44 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TRSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGGAAKKK 87
            :|.::.:::|..||||...|:..:    |..:.|.....|:|||
Mosquito   410 SRIYHQNQRADKRKAQRKARLARI----RIAKAGASAAFASKKK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 13/44 (30%)
ShalXP_061502009.1 None

Return to query results.
Submit another query.