DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and Kcns1

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_446406.1 Gene:Kcns1 / 117023 RGDID:621524 Length:497 Species:Rattus norvegicus


Alignment Length:44 Identity:14/44 - (31%)
Similarity:18/44 - (40%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RKAKGRKAQGTGRMRYLKNLRRRFR--------NGLREGGAAKK 86
            |.|.|.:....|::..:..|.|.||        .|||..||..|
  Rat   299 RGASGEELGDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 14/44 (32%)
Kcns1NP_446406.1 BTB_2 21..120 CDD:280393
BTB 23..125 CDD:197585
Ion_trans 238..439 CDD:278921 14/44 (32%)
Ion_trans_2 355..433 CDD:285168
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 392..397
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 464..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.