DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and Kcnd1

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001099218.1 Gene:Kcnd1 / 116695 RGDID:621364 Length:650 Species:Rattus norvegicus


Alignment Length:87 Identity:22/87 - (25%)
Similarity:35/87 - (40%) Gaps:15/87 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTTSFGKRHNKTHTICRR-CGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMRYL 67
            |..|.|.|.:::.::..: .|..|  |..|.||:.|...|       .|.|....:...|.|:.|
  Rat   504 GAVSLGGRTSRSTSVSSQPMGPGS--LFSSCCSRRGERRA-------IRLANSTASVSRGSMQEL 559

  Fly    68 KNLRRRFRNGLREGGAAKKKTN 89
            ..|.     |||...|.:.:::
  Rat   560 DTLA-----GLRRSPAPQSRSS 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 22/85 (26%)
Kcnd1NP_001099218.1 BTB_POZ 6..143 CDD:453885
Ion_trans 185..417 CDD:459842
DUF3399 470..550 CDD:463381 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.