DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and Rpl37rt

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001258519.1 Gene:Rpl37rt / 100502825 MGIID:3651519 Length:97 Species:Mus musculus


Alignment Length:87 Identity:58/87 - (66%)
Similarity:68/87 - (78%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMR 65
            |||||:|||||.|||||:|||||:.:||||||.|.:|||||.:.|.:|||.|||.|...||||||
Mouse     1 MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMR 65

  Fly    66 YLKNLRRRFRNGLREGGAAKKK 87
            :||.:.||||:|.|||...|.|
Mouse    66 HLKIVYRRFRHGFREGTTPKPK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 58/87 (67%)
Rpl37rtNP_001258519.1 PTZ00073 1..88 CDD:240257 58/87 (67%)

Return to query results.
Submit another query.