DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and kcnc1b

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001182126.2 Gene:kcnc1b / 100334453 ZFINID:ZDB-GENE-080414-3 Length:598 Species:Danio rerio


Alignment Length:51 Identity:14/51 - (27%)
Similarity:19/51 - (37%) Gaps:17/51 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KRHNK---------THTICRRCGNS---SYH-----LQKSKCSQCGYPAAK 43
            |:.||         :...||...||   |.|     |.:.:.|:..||..|
Zfish   453 KKKNKHIRRPPLLGSPNYCRSAVNSPRPSTHSDTCPLAQEEVSEIRYPDFK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 14/51 (27%)
kcnc1bNP_001182126.2 None

Return to query results.
Submit another query.