DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and kcnf1b

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:XP_005157014.1 Gene:kcnf1b / 100334378 ZFINID:ZDB-GENE-090312-39 Length:484 Species:Danio rerio


Alignment Length:48 Identity:12/48 - (25%)
Similarity:18/48 - (37%) Gaps:21/48 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CGNSSYHLQKS--------KCSQCG-----YPAAK--------TRSFN 48
            |.:||...:|.        :...||     ||.::        ||||:
Zfish    12 CNSSSSSDEKEIAVNIGGVRLVLCGDILNRYPDSRLAELVNCPTRSFD 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 12/48 (25%)
kcnf1bXP_005157014.1 BTB_POZ_Kv5_KCNF1 22..136 CDD:349690 8/38 (21%)
Ion_trans 179..415 CDD:459842
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.