DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and ISX

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001290437.1 Gene:ISX / 91464 HGNCID:28084 Length:245 Species:Homo sapiens


Alignment Length:192 Identity:64/192 - (33%)
Similarity:84/192 - (43%) Gaps:42/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRK-PRRNRTT 123
            ||::.|  :|..|........|.....||..|...|:....|     |.......|| .||.|||
Human    31 FSIEAI--LKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKP-----PKDQPQEGRKSKRRVRTT 88

  Fly   124 FSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNER----------- 177
            |::.||..|||:|..|||||..:|.:||.:::|.|||||:||||:|||:|:.|:           
Human    89 FTTEQLHELEKIFHFTHYPDVHIRSQLAARINLPEARVQIWFQNQRAKWRKQEKIGNLGAPQQLS 153

  Fly   178 --SVGSRTLLDTA---------PQLVP----APISNNMHKYANMP--------HPHPQPPPP 216
              ||...|.||.|         .:|.|    .|.:.:....|..|        ||....|.|
Human   154 EASVALPTNLDVAGPTWTSTALRRLAPPTSCCPSAQDQLASAWFPAWITLLPAHPWETQPVP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 31/51 (61%)
ISXNP_001290437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..86 13/52 (25%)
Homeobox 86..138 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.