DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and RHOXF2

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_115887.1 Gene:RHOXF2 / 84528 HGNCID:30011 Length:288 Species:Homo sapiens


Alignment Length:294 Identity:71/294 - (24%)
Similarity:116/294 - (39%) Gaps:93/294 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNIMEMKHDAY---SKGKMAMELSS 84
            |....:..:|..|..::.|.:|:|......:|       .:.:.|.:.||.   .:|..|.|...
Human     4 PDQCSQYMTSLLSPAVDDEKELQDMNAMVLSL-------TEEVKEEEEDAQPEPEQGTAAGEKLK 61

  Fly    85 NFGPTGA---------------------------GCGGAD------------------RPAPCSG 104
            :.|..|.                           |..|:|                  ||....|
Human    62 SAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVG 126

  Fly   105 NLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRR 169
            .|..|   ::::|  |...|:..||..||::|:|..:|..|:|..||..::::|..||:||:|||
Human   127 GLEPG---NAQQP--NVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRR 186

  Fly   170 AKFRRNERSVGSRTLLD----------TAPQLVPAPI-SNNM-------HKYAN-----MPHPHP 211
            ||:||::|::.:|.:|.          ||.:.:.||: .:.|       |.:::     || |.|
Human   187 AKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMP-PFP 250

  Fly   212 QP---------PPPPGAYALNFGPLELRSCQNYT 236
            .|         ||.|.|....|||.......::|
Human   251 PPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFT 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 22/51 (43%)
RHOXF2NP_115887.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..136 21/129 (16%)
Homeobox 140..190 CDD:278475 22/49 (45%)
Nuclear localization signal. /evidence=ECO:0000250 186..195 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.