DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB-1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_174164.2 Gene:HB-1 / 839740 AraportID:AT1G28420 Length:1705 Species:Arabidopsis thaliana


Alignment Length:117 Identity:36/117 - (30%)
Similarity:56/117 - (47%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KPRRN-RTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERS- 178
            ||:|. :|.|   ||..||||:....||....|.||:.|:.||:.::|:||.:||.|.:::.:| 
plant    40 KPKRQMKTPF---QLETLEKVYSEEKYPSEATRAELSEKLDLSDRQLQMWFCHRRLKDKKDGQSN 101

  Fly   179 ---------VGSRTL--LDTAPQLVP--------------APISNNMHKYAN 205
                     |.|.::  |..|...||              :|.||:...:|:
plant   102 KPVKSSVAAVQSASVNELPAAAGSVPEQDSRSDSGSESGCSPYSNSRRNFAS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 23/56 (41%)
HB-1NP_174164.2 Homeodomain 40..96 CDD:459649 25/58 (43%)
DDT 550..605 CDD:460696
HARE-HTH 731..799 CDD:461541
WHIM1 936..975 CDD:464774
WSD 1099..1173 CDD:464775
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.