DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and AtHB23

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:74 Identity:14/74 - (18%)
Similarity:32/74 - (43%) Gaps:4/74 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LRKYHNDTRKDLNVLFFPCFQFGSKESPDEIVQRFESSTDSSGMIGEIFTEIEVN---GSKAPGL 118
            :.:||....:.|: |..|...:..:|.|....::..::....|:.|:.......|   |.::..:
plant   445 IAQYHQHLAEKLD-LELPALLYMMREFPGTEEEKMRAAIGRFGLTGKAQVMPMKNLSDGQRSRVI 508

  Fly   119 YKYLKAKKP 127
            :.:|..|:|
plant   509 FAWLAYKQP 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 3/10 (30%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696
HALZ 126..167 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.