DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB5

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_201334.1 Gene:HB5 / 836656 AraportID:AT5G65310 Length:312 Species:Arabidopsis thaliana


Alignment Length:200 Identity:46/200 - (23%)
Similarity:72/200 - (36%) Gaps:45/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPA-PCSGNLP--AGGGHHSRKPRRNRT 122
            |:...:.::|....|.......::.|..:|||.......| ...|:|.  .|.||.|......:.
plant    10 SLSGFLPIRHSTTDKQISPRPTTTGFLYSGAGDYSQMFDALEDDGSLEDLGGVGHASSTAAEKKR 74

  Fly   123 TFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRN--ERSVG----- 180
            .....|:.||||.||..:..:...:.:||.::.|...:|.:|||||||:::..  ||..|     
plant    75 RLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSN 139

  Fly   181 --------------SRTLLDTAPQL----------------VPAPISNNMHKYAN-----MPHPH 210
                          :.:||....:|                ....:..|....||     :.|..
plant   140 FDALKRNRDSLQRDNDSLLGQIKELKAKLNVEGVKGIEENGALKAVEANQSVMANNEVLELSHRS 204

  Fly   211 PQPPP 215
            |.|||
plant   205 PSPPP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 18/55 (33%)
HB5NP_201334.1 Homeodomain 72..125 CDD:459649 18/52 (35%)
HALZ 127..168 CDD:460477 6/40 (15%)

Return to query results.
Submit another query.