DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HDG7

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001332093.1 Gene:HDG7 / 835293 AraportID:AT5G52170 Length:687 Species:Arabidopsis thaliana


Alignment Length:185 Identity:41/185 - (22%)
Similarity:63/185 - (34%) Gaps:66/185 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KLEDREESGRNL--DKIHRFSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGN 105
            ||:|.|...|:|  |.....|.|   |.|.:...|.|                            
plant    22 KLKDDEFESRSLSDDSFDAMSGD---EDKQEQRPKKK---------------------------- 55

  Fly   106 LPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRA 170
                    .||.:.:|.|  |.|:..||..|:...:|:...|.||..|:.|...:::.||||||.
plant    56 --------KRKTKYHRHT--SYQIQELESFFKECPHPNEKQRLELGKKLTLESKQIKFWFQNRRT 110

  Fly   171 KFR-------------RNER----------SVGSRTLLDTAPQLVPAPISNNMHK 202
            :.:             .||:          |:.....:|....::|..:|...|:
plant   111 QMKTQLERHENVILKQENEKLRLENSFLKESMRGSLCIDCGGAVIPGEVSFEQHQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 19/68 (28%)
HDG7NP_001332093.1 Homeodomain 61..113 CDD:459649 19/53 (36%)
START_ArGLABRA2_like 220..425 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.