DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB51

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:84 Identity:25/84 - (29%)
Similarity:41/84 - (48%) Gaps:16/84 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RKPRRN-----RTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFR- 173
            |.|..|     :...:|.||.:||:.|:.....|:..:.:|:.::.|...::.||||||||::: 
plant    67 RFPNNNNEMIKKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKA 131

  Fly   174 ----------RNERSVGSR 182
                      |.|..|.||
plant   132 KQLEQLYDSLRQEYDVVSR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 18/71 (25%)
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 17/52 (33%)
HALZ 132..166 CDD:460477 5/19 (26%)

Return to query results.
Submit another query.