DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB-3

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:194 Identity:39/194 - (20%)
Similarity:64/194 - (32%) Gaps:77/194 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQLH-----------SLP-------VGNPGNFYYGPTVSGEIYSSHQSHNLESE-----DKLEDR 47
            ||||           |||       .|..||:....::|....|.|  |:|..:     :.:.|:
plant    32 QQLHEDNAHHLPSPTSLPSCPPHLFYGGGGNYMMNRSMSFTGVSDH--HHLTQKSPTTTNNMNDQ 94

  Fly    48 EESGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGH 112
            ::.|.                                                  ..||...|.|
plant    95 DQVGE--------------------------------------------------EDNLSDDGSH 109

  Fly   113 HSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNE 176
            .....::.|....  |:.||||.||..:..:...:.:||..:.|...::.:|||||||:::..:
plant   110 MMLGEKKKRLNLE--QVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQ 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 18/55 (33%)
HB-3NP_568309.2 Homeodomain 115..168 CDD:459649 18/54 (33%)
HALZ 170..208 CDD:460477 0/2 (0%)

Return to query results.
Submit another query.