DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HAT22

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:244 Identity:51/244 - (20%)
Similarity:83/244 - (34%) Gaps:72/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EESGRNLDKIHRF-SVDNIM---------EMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPC 102
            ::|...:|  ||| .:|..:         ::|..|.:..::..:.||:.|.:....|...|....
plant    29 KKSSSTVD--HRFIRLDPSLTLSLSGESYKIKTGAGAGDQICRQTSSHSGISSFSSGRVKREREI 91

  Fly   103 SGNLPAGGGHHSRK---------------------PRRNRTTFSSAQLTALEKVFERTHYPDAFV 146
            ||    |.|....:                     ..|.:...:..|...||..|:.....:...
plant    92 SG----GDGEEEAEETTERVVCSRVSDDHDDEEGVSARKKLRLTKQQSALLEDNFKLHSTLNPKQ 152

  Fly   147 REELATKVHLSEARVQVWFQNRRAKFRRNERSVG--------------SRTLLDTAPQLVPAPIS 197
            ::.||.:::|...:|:||||||||:.:..:..|.              :|.|......|....:|
plant   153 KQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLS 217

  Fly   198 NNMHKYANMPHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGSSG 246
            ...  |.:||           |..|...|    ||:.    .||.|..|
plant   218 QPF--YMHMP-----------AATLTMCP----SCER----LGGGGVGG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 16/51 (31%)
HAT22NP_195493.1 Homeobox 129..179 CDD:278475 16/49 (33%)
HALZ 181..224 CDD:128634 6/44 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.