DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and ANL2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_567183.2 Gene:ANL2 / 828022 AraportID:AT4G00730 Length:802 Species:Arabidopsis thaliana


Alignment Length:176 Identity:47/176 - (26%)
Similarity:78/176 - (44%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YGPTVSGEIY-SSHQSHNLESEDKLEDREES-----------GRNLD-KIHRFSVDNIMEMKHDA 72
            :.|.::..:| ||..|..||..::..:|.|:           |...| .::|.|    .|.:|::
plant    51 FSPPLTKSVYASSGLSLALEQPERGTNRGEASMRNNNNVGGGGDTFDGSVNRRS----REEEHES 111

  Fly    73 YSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFE 137
            .| |...:|     |.:|.....||:|              .||.|.:|.|  ..|:..||.:|:
plant   112 RS-GSDNVE-----GISGEDQDAADKP--------------PRKKRYHRHT--PQQIQELESMFK 154

  Fly   138 RTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFR----RNERSV 179
            ...:||...|.||:.::.|...:|:.||||||.:.:    |:|.::
plant   155 ECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENAL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 20/59 (34%)
ANL2NP_567183.2 Homeodomain 135..190 CDD:459649 21/56 (38%)
START_ArGLABRA2_like 319..542 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.