DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HAT1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:246 Identity:60/246 - (24%)
Similarity:88/246 - (35%) Gaps:60/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NYQQQLHSLPVGNP-GNFYYGPTVSGEIYSSHQS----------HNLESEDKLEDREESGRNLDK 56
            |:..||:..|..:| .|....|.....:.||.|.          ::|.:...||  ||:|     
plant    19 NHPLQLNLKPTSSPMSNLQMFPWNQTLVSSSDQQKQQFLRKIDVNSLPTTVDLE--EETG----- 76

  Fly    57 IHRFSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCGG-----ADRPAP--CSGNLPAGGGHHS 114
                 |.:.........|..:.:.|..   |.:|.|||.     .||.:.  .|......||...
plant    77 -----VSSPNSTISSTVSGKRRSTERE---GTSGGGCGDDLDITLDRSSSRGTSDEEEDYGGETC 133

  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV 179
            ||..|    .|..|...||..|:..:..:...:..||.|:.|:..:|:||||||||:.:..:..|
plant   134 RKKLR----LSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEV 194

  Fly   180 G--------------SRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPP 216
            .              :|.|...|.:|....:|         |..:.|..||
plant   195 DCEYLKRCVEKLTEENRRLEKEAAELRALKLS---------PRLYGQMSPP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 18/51 (35%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 19/90 (21%)
HOX 134..188 CDD:197696 21/57 (37%)
HALZ 190..233 CDD:128634 7/51 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.