DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB-2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:165 Identity:42/165 - (25%)
Similarity:63/165 - (38%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKF--- 172
            |.:|||..|    .|..|...||:.|:.....:...::.||.::.|...:|:||||||||:.   
plant   124 GDNSRKKLR----LSKDQSAILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTKLK 184

  Fly   173 --------------------RRNERSVGSRTLLDTAPQL---VPAPISNNM---HKYANMPHPHP 211
                                ||.::.|.....|..:||.   :..|.:..|   .::.::|.|.|
plant   185 QTEVDCEFLRRCCENLTEENRRLQKEVTELRALKLSPQFYMHMSPPTTLTMCPSCEHVSVPPPQP 249

  Fly   212 QPPP-------PPGAYA--------LNFGPLELRS 231
            |...       |..|:|        |.|..|..||
plant   250 QAATSAHHRSLPVNAWAPATRISHGLTFDALRPRS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 18/78 (23%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:461370
HOX 128..182 CDD:197696 20/57 (35%)
HALZ 184..227 CDD:128634 6/42 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.