DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB-2

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:165 Identity:42/165 - (25%)
Similarity:63/165 - (38%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKF--- 172
            |.:|||..|    .|..|...||:.|:.....:...::.||.::.|...:|:||||||||:.   
plant   124 GDNSRKKLR----LSKDQSAILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTKLK 184

  Fly   173 --------------------RRNERSVGSRTLLDTAPQL---VPAPISNNM---HKYANMPHPHP 211
                                ||.::.|.....|..:||.   :..|.:..|   .::.::|.|.|
plant   185 QTEVDCEFLRRCCENLTEENRRLQKEVTELRALKLSPQFYMHMSPPTTLTMCPSCEHVSVPPPQP 249

  Fly   212 QPPP-------PPGAYA--------LNFGPLELRS 231
            |...       |..|:|        |.|..|..||
plant   250 QAATSAHHRSLPVNAWAPATRISHGLTFDALRPRS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 17/74 (23%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:282474
HOX 128..182 CDD:197696 20/57 (35%)
HALZ 184..227 CDD:128634 6/42 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.