DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HDG1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_191674.1 Gene:HDG1 / 825287 AraportID:AT3G61150 Length:808 Species:Arabidopsis thaliana


Alignment Length:158 Identity:39/158 - (24%)
Similarity:64/158 - (40%) Gaps:51/158 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSSNFGPTG 90
            :|||..|:.|......:.:|.|.||            ||...:..|         :|.:      
plant    66 NGEIMESNVSRKSSRGEDVESRSES------------DNAEAVSGD---------DLDT------ 103

  Fly    91 AGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVH 155
                 :|||.             .:|.|.:|.|  ..|:..||.||:...:||...|.:|:.:::
plant   104 -----SDRPL-------------KKKKRYHRHT--PKQIQDLESVFKECAHPDEKQRLDLSRRLN 148

  Fly   156 LSEARVQVWFQNRRAKFR----RNERSV 179
            |...:|:.||||||.:.:    |:|.::
plant   149 LDPRQVKFWFQNRRTQMKTQIERHENAL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 20/59 (34%)
HDG1NP_191674.1 COG5576 69..185 CDD:227863 37/155 (24%)
Homeodomain 111..166 CDD:459649 21/56 (38%)
START_ArGLABRA2_like 314..537 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.