DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HAT3

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:118 Identity:27/118 - (22%)
Similarity:42/118 - (35%) Gaps:37/118 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVNFSTKDATFEKVLSLLTPLLRKYHNDTRKDLNVL-FFPCFQFGSKESPDEIVQRFESSTDSSG 99
            :|:||.::...|..|.:|..|       .:::.:|| |...|..       |:....|.:..::.
plant   339 VVDFSKQEQKIESTLQILQTL-------PKENYDVLQFLTAFLV-------EVSSHNEQNKMTTT 389

  Fly   100 MIGEIFTEIEVNGSKAPGLY------KYLKAKKPGNCGGFINSNFTIFLTDRQ 146
            .:..:|         .|.|.      ..|||..|.|       .||.||.|.|
plant   390 NLAVVF---------GPNLLWVKDAAMTLKAINPIN-------TFTKFLLDNQ 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 12/35 (34%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:461370
Homeodomain 161..215 CDD:459649
HALZ 217..260 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.