DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB20

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:79 Identity:26/79 - (32%)
Similarity:39/79 - (49%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 NLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRR 169
            ||...|.|.....::.|....  |:.||||.||..:..:...:.:||..:.:...::.:||||||
plant    74 NLSDDGAHTMLGEKKKRLQLE--QVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRR 136

  Fly   170 A--KFRRNERSVGS 181
            |  |.|:.||...|
plant   137 ARWKTRQLERDYDS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 18/57 (32%)
HB20NP_186771.1 Homeodomain 87..140 CDD:459649 17/54 (31%)
HALZ 142..183 CDD:460477 4/9 (44%)

Return to query results.
Submit another query.