DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB4

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:208 Identity:53/208 - (25%)
Similarity:80/208 - (38%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNIMEMKHD-AYSKGKMAM 80
            |:|..|..|: ...||....:||.|..:.....|          :|.::...|.| |.::|....
plant    81 GSFLRGFNVN-RAQSSVAVVDLEEEAAVVSSPNS----------AVSSLSGNKRDLAVARGGDEN 134

  Fly    81 ELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAF 145
            |........|.|.||:|       :...|.|..|||..|    .|..|...||:.|:.....:..
plant   135 EAERASCSRGGGSGGSD-------DEDGGNGDGSRKKLR----LSKDQALVLEETFKEHSTLNPK 188

  Fly   146 VREELATKVHLSEARVQVWFQNRRAKFRRNERSVG--------------SRTLLDTAPQLVPAPI 196
            .:..||.:::|...:|:||||||||:.:..:..|.              :|.|.....:|....:
plant   189 QKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELRALKL 253

  Fly   197 SNNMHKYANMPHP 209
            |  .|.|.:|..|
plant   254 S--PHLYMHMTPP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 17/51 (33%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:398351 12/53 (23%)
Homeobox 166..216 CDD:395001 18/53 (34%)
HALZ 218..261 CDD:128634 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.