DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HB22

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:80 Identity:21/80 - (26%)
Similarity:39/80 - (48%) Gaps:11/80 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 AGGGHHSRK---PRRNRTTFSSAQLTALEKVF--ERTHYPDAFV------REELATKVHLSEARV 161
            :|.|..|..   ..:.:...:|.||..||:.|  |....||..:      :.:|:.::.|...::
plant    56 SGYGEESNSFNGQEKKKKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQI 120

  Fly   162 QVWFQNRRAKFRRNE 176
            .||||||:|:::..:
plant   121 AVWFQNRKARWKNKQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 18/63 (29%)
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 18/62 (29%)
HALZ 134..167 CDD:460477 0/2 (0%)

Return to query results.
Submit another query.