DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Rhox13

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:178 Identity:53/178 - (29%)
Similarity:76/178 - (42%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYSSHQSHNL-------ESEDKLEDREESGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSSNF 86
            :.|||.|...       |||...|...:|....|     |.|:..|...|:.:..:...:.....
Mouse    48 VASSHDSGGAIGCATVKESESDSESESDSESESD-----SSDSSDESDDDSSTSDEDTSDPEEAA 107

  Fly    87 GPTGAGCGGADRP--APCSGNLPAGGGHHSRKPRRNRTT--------FSSAQLTALEKVFERTHY 141
            .|:.|....|..|  .|.:..:...|.:..|.|||:...        |:..|:..:|.:||.|.|
Mouse   108 APSVAAVAAAAAPPTVPAAAAIQIPGPYRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQY 172

  Fly   142 PDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAP 189
            ||...|.|||..:::.|.:|:|||.|||||.|:.||    |.:|...|
Mouse   173 PDLLTRGELARTLNVPEVKVKVWFTNRRAKQRKIER----REMLRNIP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 25/63 (40%)
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 16/70 (23%)
Homeodomain 155..205 CDD:459649 23/49 (47%)

Return to query results.
Submit another query.