DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Isx

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001281207.1 Gene:Isx / 71597 MGIID:1918847 Length:242 Species:Mus musculus


Alignment Length:150 Identity:57/150 - (38%)
Similarity:79/150 - (52%) Gaps:40/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERS- 178
            :..||.||||::.||..|||:|..|||||..||.:||::::|.|||||:||||:|||:|:.|:| 
Mouse    76 KNKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINLPEARVQIWFQNQRAKWRKQEKSG 140

  Fly   179 -------------------VGSR-----TLLDTAP-QLVP--------APISNN-----MHKYAN 205
                               :|:.     ||.|:|| :|||        ||:...     .|..:.
Mouse   141 NLSAPQQPGSCADTHCYDYIGTSHRMLPTLSDSAPFKLVPYTDSPCPMAPMGPTAPAWPSHPASL 205

  Fly   206 MPHPH-PQPPPPPGAYALNF 224
            .|:.| |.|.|..|.:..||
Mouse   206 CPYLHVPTPTPQVGQHLCNF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 32/51 (63%)
IsxNP_001281207.1 Homeobox 82..134 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.