DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and LOC691272

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_001077477.1 Gene:LOC691272 / 691272 RGDID:1586239 Length:199 Species:Rattus norvegicus


Alignment Length:216 Identity:54/216 - (25%)
Similarity:85/216 - (39%) Gaps:55/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YYGPTVSGEIYSSHQSHNLESEDKLEDREESGR--NLDKIHRFSVDNIMEMKHDAYSKGKMAMEL 82
            |||.    :.|          |:::....:.||  ..|..|...|..|  :|..:|    |...|
  Rat    12 YYGV----DFY----------EEEVTTELQQGRAATADGSHTEEVIGI--LKELSY----MNAVL 56

  Fly    83 SSNFGPTGAGCGGADRP--APCSGNLPAGGGHHSRKPRRNRTT-------FSSAQLTALEKVFER 138
            ..|:          :||  :...|| |........:|...:.|       |:..||..|::|||.
  Rat    57 DHNY----------NRPMKSDTRGN-PQEPAQEEEEPVFQKPTTYYRKLKFTPEQLLELDRVFEE 110

  Fly   139 THYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAPQLVPAPISNNMHK- 202
            |.||||..|:|||..:::.|..|::||..||||.|::::::....:|.......|..:...... 
  Rat   111 TQYPDALQRKELAKLINVEEYTVKIWFNKRRAKIRKHQKALPCTNILPDKQNYFPMRVLKETKNV 175

  Fly   203 -----------YANMPH-PHP 211
                       :.:.|| .||
  Rat   176 VVLQEPPVDEFFCSQPHVGHP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 25/58 (43%)
LOC691272XP_001077477.1 Homeobox 96..145 CDD:278475 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.