DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and DRGX

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011538391.1 Gene:DRGX / 644168 HGNCID:21536 Length:298 Species:Homo sapiens


Alignment Length:163 Identity:60/163 - (36%)
Similarity:71/163 - (43%) Gaps:70/163 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GHHS----------RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQ--- 162
            |:||          ||.|||||||:..||.|||.||.:|||||.|.|||||.|::|:|||||   
Human    17 GNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQLAN 81

  Fly   163 --------------------------------VWFQNRRAKFRRNERSVGSRTLLDTAP------ 189
                                            |||||||||:|:.||...     |..|      
Human    82 SCLKTELQIEINDTIIEHSEVEDHNFSLKGARVWFQNRRAKWRKTERGAS-----DQEPGAKEPM 141

  Fly   190 -QLVPAPISNNMHKYANMPHPHPQPPPPPGAYA 221
             ::.|.|:.|     .|        .||||..|
Human   142 AEVTPPPVRN-----IN--------SPPPGDQA 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 41/90 (46%)
DRGXXP_011538391.1 Homeodomain 34..125 CDD:459649 41/90 (46%)
OAR 236..253 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.