DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and ALX4

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_068745.2 Gene:ALX4 / 60529 HGNCID:450 Length:411 Species:Homo sapiens


Alignment Length:227 Identity:80/227 - (35%)
Similarity:102/227 - (44%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SSNFGPTGAGCGG------ADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHY 141
            ||......||..|      :|.|:|..   .|....:..|.|||||||:|.||..|||||::|||
Human   177 SSYLSVKEAGVKGPQDRASSDLPSPLE---KADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHY 238

  Fly   142 PDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGS----RTLLDTAPQLVPAPISNNMHK 202
            ||.:.||:||.:..|:||||||||||||||:|:.|| .|.    ||...||.:|   |:......
Human   239 PDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRER-FGQMQQVRTHFSTAYEL---PLLTRAEN 299

  Fly   203 YANMPHPH-------PQPPP------------------PPGAYALNFGPLELRSCQNYTNCYGGF 242
            ||.:.:|.       ..|.|                  |||:.|        .|..::.:..|..
Human   300 YAQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGA--------SSVTDFLSVSGAG 356

  Fly   243 GSSGASGSGVCSFFGATNYCVAAN-YAKNAYP 273
            ...|.:..|  |.|||.:.....| |..|..|
Human   357 SHVGQTHMG--SLFGAASLSPGLNGYELNGEP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 36/51 (71%)
ALX4NP_068745.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..219 11/37 (30%)
Homeobox 218..270 CDD:278475 36/51 (71%)
OAR 387..404 CDD:281777 80/227 (35%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 391..404
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.