DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Crx

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_068627.2 Gene:Crx / 60446 RGDID:620511 Length:299 Species:Rattus norvegicus


Alignment Length:120 Identity:46/120 - (38%)
Similarity:60/120 - (50%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV 179
            ||.||.||||:.:||..||.:|.:|.|||.:.|||:|.|::|.|:||||||:|||||.|:..:..
  Rat    37 RKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQ 101

  Fly   180 GSRTLLDTAPQLVPAPISNNMHKYANMPHP---------------HPQPPPPPGA 219
            ..:    ..|..|.|.......|....|.|               .|..|.|.|:
  Rat   102 KQQ----QQPPGVQAKARPAKRKAGTSPRPSTDVCTDPLGISDSYSPSLPGPSGS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 33/55 (60%)
CrxNP_068627.2 Homeodomain 40..93 CDD:459649 31/52 (60%)
TF_Otx 164..249 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.