DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Drgx

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:179 Identity:63/179 - (35%)
Similarity:82/179 - (45%) Gaps:41/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNER-- 177
            ||.|||||||:..||..||..|.:|||||.|.||:||.|::|:||||||||||||||:|:.||  
  Fly    50 RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLK 114

  Fly   178 --------SVGSRTL--------------------LDTAP--QLVPAPISN-NMHKYANMPHPHP 211
                    ...|.:|                    :|..|  |...:|::| .|.:..:..|.|.
  Fly   115 DEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHS 179

  Fly   212 QPPPPPGAYAL----NFGPLELRSC----QNYTNCYGGFGSSGASGSGV 252
            ....|.|...|    |..||.....    .:.:...|...:...|.||:
  Fly   180 HSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGM 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 35/51 (69%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 35/51 (69%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.