Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038539.1 | Gene: | alx1 / 565176 | ZFINID: | ZDB-GENE-050419-191 | Length: | 320 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 70/195 - (35%) |
---|---|---|---|
Similarity: | 94/195 - (48%) | Gaps: | 51/195 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 CSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQ 166
Fly 167 NRRAKFRRNER-----------------SVGSRTLLDTAPQLVPAPISNNM--------HKYANM 206
Fly 207 PHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGF-----GSSGASGSGVCSFFGATNYCVAAN 266
Fly 267 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9876 | NP_611756.1 | Homeobox | 121..173 | CDD:278475 | 38/51 (75%) |
alx1 | NP_001038539.1 | Homeobox | 123..176 | CDD:278475 | 38/52 (73%) |
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 | 180..320 | 24/120 (20%) | |||
OAR | 296..313 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 300..313 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24329 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |