DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and alx1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001038539.1 Gene:alx1 / 565176 ZFINID:ZDB-GENE-050419-191 Length:320 Species:Danio rerio


Alignment Length:195 Identity:70/195 - (35%)
Similarity:94/195 - (48%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 CSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQ 166
            |..|:      .|.|.||:||||:||||..|||||::|||||.:|||:||.:..|:|||||||||
Zfish   111 CDSNV------SSSKKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQ 169

  Fly   167 NRRAKFRRNER-----------------SVGSRTLLDTAPQLVPAPISNNM--------HKYANM 206
            |||||:|:.||                 |:..||  |:..|     ||||:        ...::.
Zfish   170 NRRAKWRKRERYGQIQQAKSHFAATYDISMLPRT--DSYSQ-----ISNNLWTGPSAGSSVVSSC 227

  Fly   207 PHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGF-----GSSGASGSGVCSFFGATNYCVAAN 266
            ..|...||.....|     |...|:.:   :.|.||     ...|.:...:.:||..:....:||
Zfish   228 MIPRGSPPCVTSPY-----PHSPRAAE---HGYVGFPNHQQNQFGVNHVSLNNFFADSLLASSAN 284

  Fly   267  266
            Zfish   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 38/51 (75%)
alx1NP_001038539.1 Homeobox 123..176 CDD:278475 38/52 (73%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 180..320 24/120 (20%)
OAR 296..313 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 300..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.