DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and drgx

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001032182.1 Gene:drgx / 560399 ZFINID:ZDB-GENE-070330-1 Length:287 Species:Danio rerio


Alignment Length:207 Identity:69/207 - (33%)
Similarity:90/207 - (43%) Gaps:70/207 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GGGHHS----------RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQV 163
            |.|:|:          ||.|||||||:..||.|||.||.:|||||.|.|||||.|::|:||||||
Zfish    24 GFGNHASGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFAREELAMKINLTEARVQV 88

  Fly   164 WFQNRRAKFRRNERSV----GSRTLLD----TAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAY 220
            ||||||||:|:.||..    |.:..::    .|..|..:|:.::..|..                
Zfish    89 WFQNRRAKWRKTERGTSEQDGGKEQMNEGNPPARNLNQSPVDHSRSKKE---------------- 137

  Fly   221 ALNFGPLELRSCQNYTNCYGGFGS-----------------------SGASGSGVCSFFGATNYC 262
                 |:||:  ||.....|..|.                       :...||.:||      .|
Zfish   138 -----PMELQ--QNINRVVGSGGPFFPSCLPGTLLNTATYAQALSQVATLKGSPLCS------CC 189

  Fly   263 VAANYAKNAYPP 274
            |......:..||
Zfish   190 VPDPMGLSFLPP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 38/51 (75%)
drgxNP_001032182.1 Homeobox 46..98 CDD:278475 38/51 (75%)
OAR 207..223 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.