DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and hbn

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:307 Identity:89/307 - (28%)
Similarity:117/307 - (38%) Gaps:111/307 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQQLHSLPVGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLE---DREESGRNLDKIHRFSVDNIM 66
            |||.||                   ...|.|...:.:.:|:   .||:|..|.|  ....|||  
  Fly    89 QQQQHS-------------------QQQHHSQQQQQQQQLQVQAKREDSPTNTD--GGLDVDN-- 130

  Fly    67 EMKHDAYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTA 131
               .|         ||||:.. .|......:||               ||.||:||||::.||..
  Fly   131 ---DD---------ELSSSLN-NGHDLSDMERP---------------RKVRRSRTTFTTFQLHQ 167

  Fly   132 LEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAPQLVPA-- 194
            ||:.||:|.|||.|.||:||.::.||||||||||||||||:|:.|:.:..    |.|..|:|.  
  Fly   168 LERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQ----DKAGYLLPEQG 228

  Fly   195 ----PISNNMHKYANMPHPHPQPP--------PPPGAYALNFGPLE------------------- 228
                |:...:     .||..|..|        ||..|...:|.|..                   
  Fly   229 LPEFPLGIPL-----PPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLP 288

  Fly   229 -----LRSCQNYTNCYGGFGSSGASGSGVCSFFGATNYCVAANYAKN 270
                 |......:|..|.||:..|:.:...|          |.|.:|
  Fly   289 NFHTLLSQYMGLSNLNGIFGAGAAAAAAAAS----------AGYPQN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 35/51 (69%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.