DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and meox1

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:59 Identity:26/59 - (44%)
Similarity:36/59 - (61%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174
            |.|:.||.|:..||..||..|...:|.....|.|:|..:.|:|.:|:|||||||.|::|
Zfish   169 KARKERTAFTKEQLRELEAEFTHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/55 (44%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158
Homeodomain 171..227 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.