DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Rhox8

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001004193.1 Gene:Rhox8 / 434768 MGIID:3579898 Length:320 Species:Mus musculus


Alignment Length:171 Identity:52/171 - (30%)
Similarity:73/171 - (42%) Gaps:52/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GEIYSSHQSHNLESEDKLEDREE------SGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSSN 85
            ||.....:....|.|::.|:.||      :....|:....|...:.:..|||             
Mouse   176 GEEEEEEEEEEEEEEEEEEEEEEEEEAAAAAAARDETTAGSSAPVDDRSHDA------------- 227

  Fly    86 FGPTGAGCGGADR-----------------PAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALE 133
                ||...|.||                 |:| ||.||           |||..|:..||..||
Mouse   228 ----GASSNGEDRGQGEELIPGGTKGLEALPSP-SGQLP-----------RNRYRFTKFQLQELE 276

  Fly   134 KVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174
            ::|||.|||.|..|.|||..:.::|:||:.||::||||:|:
Mouse   277 RIFERNHYPSAAARRELARWIGVTESRVENWFKSRRAKYRK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 28/55 (51%)
Rhox8NP_001004193.1 Homeodomain 262..317 CDD:459649 28/54 (52%)

Return to query results.
Submit another query.