DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Ubx

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:106 Identity:31/106 - (29%)
Similarity:53/106 - (50%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SKGKMAMELSSNFGPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFER 138
            :|.|:..:| :.:|......|.....:.....||...|.:..: ||.|.|::..|...|||.|..
  Fly   254 TKSKIRSDL-TQYGGISTDMGKRYSESLAGSLLPDWLGTNGLR-RRGRQTYTRYQTLELEKEFHT 316

  Fly   139 THYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV 179
            .||.....|.|:|..:.|:|.::::||||||.|.::..:::
  Fly   317 NHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 23/55 (42%)
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.