DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Poxm

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:278 Identity:54/278 - (19%)
Similarity:88/278 - (31%) Gaps:85/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNYQQQLHSLPVGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNI 65
            ::||   :..|...:||.|.:                     ::.||..|....||.:..||.:|
  Fly    88 VVNY---IRELKQRDPGIFAW---------------------EIRDRLLSEGICDKTNVPSVSSI 128

  Fly    66 MEMKHD-------AYSKGKMAMELSSNFGPTGAGCGGADRPAPCSGNL-------PAGGGHHSRK 116
            ..:..:       .::.|.:....||:.|.:.:..||.:.....|.|:       |.||.||   
  Fly   129 SRILRNKLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHH--- 190

  Fly   117 PRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGS 181
            |..:....|:|...:...|....|           ...||..:..|.:             |..:
  Fly   191 PHHHHHHQSAAAAASAHHVHAHAH-----------AHAHLYNSIYQPY-------------SAAA 231

  Fly   182 RTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAYALNF-------------GPLELRSCQ 233
            ...:.| |...|:| ........::||||........|.|.::             ..:.||:  
  Fly   232 AYSMKT-PCGSPSP-PQGAGGQGSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRA-- 292

  Fly   234 NYTNCYGGFGSSGASGSG 251
               :|..|.|..|..|.|
  Fly   293 ---SCQVGVGVGGMGGMG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 7/51 (14%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.