DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Antp

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:148 Identity:35/148 - (23%)
Similarity:59/148 - (39%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VDNIMEMKHDAYSKGKMAMELSSNFGPTGA-----------------GCGGADRPAPCSGNLPAG 109
            |.::.|:..:.::.|....:  |...|.||                 |..|...|...:.|..:.
  Fly   215 VPDVTEVHQNHHNMGMYQQQ--SGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSS 277

  Fly   110 GGHHSRKP------------RRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQ 162
            |......|            :|.|.|::..|...|||.|....|.....|.|:|..:.|:|.:::
  Fly   278 GMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 342

  Fly   163 VWFQNRRAKFRRNERSVG 180
            :||||||.|:::..::.|
  Fly   343 IWFQNRRMKWKKENKTKG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 21/55 (38%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 16/92 (17%)
Homeodomain 298..354 CDD:459649 21/55 (38%)

Return to query results.
Submit another query.