DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and gsb

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:283 Identity:87/283 - (30%)
Similarity:116/283 - (40%) Gaps:81/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EDKLEDREESGRNL---------------DKIHRFSVDNIMEMKHDAYSKGKMAMELSSNFGPTG 90
            |.::|:.::|...:               ||.:..||.:|..:...:...|..    .|..|..|
  Fly    99 ESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAPSVSSISRLLRGSSGSGTS----HSIDGILG 159

  Fly    91 AGCGG------ADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREE 149
            .|.|.      ::..|..|..|       .||.||:|||||:.|:.|||::|.||.|||.:.|||
  Fly   160 GGAGSVGSEDESEDDAEPSVQL-------KRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREE 217

  Fly   150 LATKVHLSEARVQVWFQNRRAKFRR--NERSVGS----RTLLDTAPQLVPAPISN-NMHKYANMP 207
            ||....|:||||||||.||||:.|:  |.:.|.|    .|.....|....||..| .|..|::  
  Fly   218 LAQSTGLTEARVQVWFSNRRARLRKQLNTQQVPSFAPTSTSFGATPTTSAAPAPNMGMSLYSS-- 280

  Fly   208 HPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGG-----------FGSSGASGS---------GV 252
                |..|..|||            :|:. .|||           .|:|.|:.|         |.
  Fly   281 ----QSWPSSGAY------------ENHA-AYGGSVASMSPASSTSGTSSAAHSPVQTQAQQPGT 328

  Fly   253 CSFFGATNYCVA---ANYAKNAY 272
            .|.|..:.|.|.   |.|...||
  Fly   329 GSEFMTSTYGVGSSNATYPSAAY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 33/51 (65%)
gsbNP_523863.1 PAX 19..143 CDD:128645 8/43 (19%)
homeodomain 186..243 CDD:238039 36/56 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450898
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.