DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and PHDP

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:84 Identity:21/84 - (25%)
Similarity:32/84 - (38%) Gaps:20/84 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GSKESPDEIVQRFESSTDSSGMIGEIFTEIEVNGSKAPGLYKYLKAKKPGNCGGFINSNFTIFLT 143
            |||..|||     |..|:::....|   |.:.|.. :|.:         .:|...:|...|.|:.
  Fly   263 GSKILPDE-----ERPTNTASGSNE---EDDENAG-SPDI---------DDCHVIVNDKSTEFML 309

  Fly   144 DRQGVPVERLNAGIHPYTL 162
              ..|..|..|..:.|.:|
  Fly   310 --ATVVEEAGNVTLKPLSL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 9/45 (20%)
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.