DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and otp

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:92/237 - (38%) Gaps:96/237 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 MELSSNFGPTGAGCGGADRPAPCSGNLPAGGG----HHS-------------------------- 114
            :.:..|....|.|.||..    .||.:|.|||    |.|                          
  Fly    35 LPVGPNLADLGGGAGGGG----SSGGVPVGGGVARLHISGGLCDNSNALNGGNGSSGNGNGNNNN 95

  Fly   115 ------------------RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARV 161
                              .|.:|:||.|:.|||..||:.|.:|||||.|:|||:|.::.|:|:||
  Fly    96 GNGNNNNSMQQQDQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRV 160

  Fly   162 QVWFQNRRAKFRRNERSVGSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAYALNFGP 226
            ||||||||||:::.:::.   .:..|...|:|:               |..||         || 
  Fly   161 QVWFQNRRAKWKKRKKTT---NVFRTPGALLPS---------------HGLPP---------FG- 197

  Fly   227 LELRSCQNYTNCYGGFGSSGASGSGVC--SFFGATNYCVAAN 266
                  .|.||.        |.|.|:|  ..||...:.|..|
  Fly   198 ------ANITNI--------AMGDGLCGTGMFGGDRWSVGVN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 33/51 (65%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 28/47 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450895
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.