DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Alx3

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001007013.2 Gene:Alx3 / 365900 RGDID:1359270 Length:343 Species:Rattus norvegicus


Alignment Length:324 Identity:94/324 - (29%)
Similarity:119/324 - (36%) Gaps:143/324 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQQQLHSLPVGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNIMEM 68
            |.|.|...||.|.|:||.|.:              |:|:|.                        
  Rat    71 YLQDLGPGPVLNGGHFYKGSS--------------EAEEKA------------------------ 97

  Fly    69 KHDAYSKGKMAMELSSNFGPTGAGCGGADR---------PAPCSGNL--PAGGG--------HHS 114
                 ||       :::|......|.|..|         |.||..:|  |...|        ...
  Rat    98 -----SK-------AASFPQLPVDCRGGPRDGPSNVQGSPGPCLASLSVPLSPGLPDSMELAKSK 150

  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNER-- 177
            .|.||||||||:.||..|||||::|||||.:.||:||.:..|:||||||||||||||:|:.||  
  Rat   151 SKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYG 215

  Fly   178 ---------------SVGSRTLLDTAPQL-----------------------VPAP-ISNNMHKY 203
                           ||..||  |:.|||                       :|:| :|...|.:
  Rat   216 KIQEGRNPFTTAYDISVLPRT--DSHPQLQNSLWSSPGSGSPGGPCLMPPEGIPSPCMSPYSHSH 278

  Fly   204 ANM-----------PHP--------------HPQPPPPPGAY------ALNFGPLELRSCQNYT 236
            .|:           .||              |...|.|.|.|      :|...|.|..|..|:|
  Rat   279 GNVAGFMGVPASPAAHPGIYSIHGFPPALGGHSFEPSPDGDYKSPSLVSLRMKPKEPPSLLNWT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 36/51 (71%)
Alx3NP_001007013.2 Homeobox 157..210 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.