Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523670.2 | Gene: | eve / 36039 | FlyBaseID: | FBgn0000606 | Length: | 376 | Species: | Drosophila melanogaster |
Alignment Length: | 253 | Identity: | 58/253 - (22%) |
---|---|---|---|
Similarity: | 84/253 - (33%) | Gaps: | 94/253 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 GCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHL 156
Fly 157 SEARVQVWFQNRRAKFRRNERSVG------------SRTLLDTA--------PQLVP-------- 193
Fly 194 -APISNNMHKYANMP--------------------HP---------------HPQPPPPPGAYAL 222
Fly 223 NFGPLELRSCQNYTNCYGGFGSSGASGSGVCSFFG----ATNYC-VAANYAKNAYPPL 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9876 | NP_611756.1 | Homeobox | 121..173 | CDD:278475 | 24/51 (47%) |
eve | NP_523670.2 | Homeobox | 74..126 | CDD:278475 | 24/51 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450905 | |
Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I2937 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |