DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and eve

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:253 Identity:58/253 - (22%)
Similarity:84/253 - (33%) Gaps:94/253 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHL 156
            |..|::.||..|             .||.||.|:..||..|||.|.:.:|.....|.|||.:::|
  Fly    58 GSRGSEIPADPS-------------VRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNL 109

  Fly   157 SEARVQVWFQNRRAKFRRNERSVG------------SRTLLDTA--------PQLVP-------- 193
            .|:.::|||||||.|.:|...:|.            :.::|..|        |...|        
  Fly   110 PESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAA 174

  Fly   194 -APISNNMHKYANMP--------------------HP---------------HPQPPPPPGAYAL 222
             |.::.|......||                    ||               .|.||.|.|.:  
  Fly   175 AAAVATNPMMATGMPPMGMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPH-- 237

  Fly   223 NFGPLELRSCQNYTNCYGGFGSSGASGSGVCSFFG----ATNYC-VAANYAKNAYPPL 275
                      .::.:..|...:..:..:|.....|    ||.|. :.....|...|||
  Fly   238 ----------MHHPHMMGSSATGSSYSAGAAGLLGALPSATCYTGLGVGVPKTQTPPL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 24/51 (47%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450905
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.