DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HOXC6

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:191 Identity:45/191 - (23%)
Similarity:72/191 - (37%) Gaps:59/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QQQLHSLPVGNP----------GNFYYGPTVSGEIYSSHQ----------SHNLESEDKLEDREE 49
            |.:::|.|..:|          |.:.||   |...|....          .||.::....:...|
Human    46 QNRIYSTPFYSPQENVVFSSSRGPYDYG---SNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSE 107

  Fly    50 SGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSSNFGPTGAGCG-GADRPAPCSGNLPAGGGHH 113
            .||...:..:.|:.....|:           .::|:     :|.| ||||               
Human   108 QGRTAPQDQKASIQIYPWMQ-----------RMNSH-----SGVGYGADR--------------- 141

  Fly   114 SRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174
                ||.|..:|..|...|||.|....|.....|.|:|..:.|:|.::::||||||.|:::
Human   142 ----RRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 22/55 (40%)
HOXC6NP_004494.1 Antp-type hexapeptide 122..127 0/4 (0%)
Homeodomain 142..198 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.