DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HOXC5

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:121 Identity:32/121 - (26%)
Similarity:53/121 - (43%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KGKMAMELSSNFGPTGAGCGGADRPAP-----------CSGNLPAGGGHHSRKPRRNRTTFSSAQ 128
            :.|.:.|:......||...|.:..|||           .|         |....:|:||:::..|
Human   111 RAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMS---------HETDGKRSRTSYTRYQ 166

  Fly   129 LTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTL 184
            ...|||.|....|.....|.|:|..:.|:|.::::||||||.|::::.:......|
Human   167 TLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 21/55 (38%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 8/29 (28%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeodomain 156..212 CDD:459649 21/55 (38%)

Return to query results.
Submit another query.