DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HOXB4

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens


Alignment Length:70 Identity:26/70 - (37%)
Similarity:43/70 - (61%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 AGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKF 172
            |||     :|:|:||.::..|:..|||.|....|.....|.|:|..:.|||.::::||||||.|:
Human   158 AGG-----EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKW 217

  Fly   173 RRNER 177
            :::.:
Human   218 KKDHK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 22/55 (40%)
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134
Antp-type hexapeptide 141..146
Homeodomain 163..219 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.