DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and HOXA4

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:161 Identity:39/161 - (24%)
Similarity:64/161 - (39%) Gaps:49/161 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 APCSGNLPAGG--------------------------------------GHHSRKPRRNRTTFSS 126
            ||.:..:||||                                      .::..:|:|:||.::.
Human   160 APATPGVPAGGSAPACPLLLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTR 224

  Fly   127 AQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAPQL 191
            .|:..|||.|....|.....|.|:|..:.|||.:|::||||||.|::::.:...::.....:...
Human   225 QQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASA 289

  Fly   192 VPAP------ISNNMHKYANMPHPHPQPPPP 216
            ...|      .|.::|     |||||....|
Human   290 SAGPPGKAQTQSPHLH-----PHPHPSTSTP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 23/55 (42%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 2/7 (29%)
Antp-type hexapeptide 194..199 0/4 (0%)
Homeodomain 216..272 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 9/48 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.